SCOP 1.61: Domain d1kqsw_: 1kqs W:

Lineage for d1kqsw_ (1kqs W:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (7 PDB entries)

8. Domain d1kqsw_: 1kqs W: [68838]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsw_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsw_:

Sequence; same for both SEQRES and ATOM records:

>d1kqsw_ d.29.1.1 (W:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1kqsw_:

• d1kqsw_ first appeared in SCOP 1.59
  
• d1kqsw_ appears in SCOP 1.63
  
• d1kqsw_ appears in the current release, SCOPe 2.08