Lineage for d1kqsw_ (1kqs W:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132386Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
  4. 132387Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 132388Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 132389Protein Ribosomal protein L31e [54577] (1 species)
  7. 132390Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (3 PDB entries)
  8. 132392Domain d1kqsw_: 1kqs W: [68838]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsw_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsw_ d.29.1.1 (W:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1kqsw_:

Click to download the PDB-style file with coordinates for d1kqsw_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsw_: