SCOP 1.59: Domain d1kqsu_: 1kqs U:

Lineage for d1kqsu_ (1kqs U:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (3 PDB entries)

8. Domain d1kqsu_: 1kqs U: [68836]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsu_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsu_:

Sequence; same for both SEQRES and ATOM records:

>d1kqsu_ a.2.2.1 (U:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1kqsu_:

• d1kqsu_ is new in SCOP 1.59
  
• d1kqsu_ appears in SCOP 1.61
  
• d1kqsu_ appears in the current release, SCOPe 2.08