| Class g: Small proteins [56992] (61 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) ![]() |
| Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein) |
| Protein Ribosomal protein L24e [57750] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (8 PDB entries) |
| Domain d1kqst_: 1kqs T: [68835] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOP Domain Sequences for d1kqst_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqst_ g.39.1.6 (T:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d1kqst_:
View in 3DDomains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |