![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
![]() | Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries) Uniprot P10972 |
![]() | Domain d1kqss_: 1kqs S: [68834] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOPe Domain Sequences for d1kqss_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqss_ b.34.5.1 (S:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d1kqss_:
![]() Domains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |