Lineage for d1kqsr_ (1kqs R:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253778Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 253779Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 253780Family d.12.1.1: L23p [54190] (1 protein)
  6. 253781Protein Ribosomal protein L23 [54191] (1 species)
  7. 253782Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (8 PDB entries)
  8. 253785Domain d1kqsr_: 1kqs R: [68833]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsr_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsr_ d.12.1.1 (R:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1kqsr_:

Click to download the PDB-style file with coordinates for d1kqsr_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsr_: