Lineage for d1kqsq_ (1kqs Q:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191859Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
  4. 191860Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
  5. 191861Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 191862Protein Ribosomal protein L22 [54845] (2 species)
  7. 191863Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (7 PDB entries)
  8. 191865Domain d1kqsq_: 1kqs Q: [68832]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsq_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsq_ d.55.1.1 (Q:) Ribosomal protein L22 {Archaeon Haloarcula marismortui}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1kqsq_:

Click to download the PDB-style file with coordinates for d1kqsq_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsq_: