| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() |
| Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
| Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
| Domain d1kqso_: 1kqs O: [68830] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOPe Domain Sequences for d1kqso_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqso_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida
Timeline for d1kqso_:
View in 3DDomains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |