Lineage for d1kqso_ (1kqs O:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283987Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 283988Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 283989Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 283990Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 283991Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (12 PDB entries)
  8. 283994Domain d1kqso_: 1kqs O: [68830]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqso_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqso_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqso_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1kqso_:

Click to download the PDB-style file with coordinates for d1kqso_.
(The format of our PDB-style files is described here.)

Timeline for d1kqso_: