Lineage for d1kqsk_ (1kqs K:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310498Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 310499Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 310500Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 310501Protein Ribosomal protein L15 (L15p) [52082] (1 species)
  7. 310502Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (12 PDB entries)
  8. 310505Domain d1kqsk_: 1kqs K: [68826]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsk_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsk_:

Sequence, based on SEQRES records: (download)

>d1kqsk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1kqsk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOP Domain Coordinates for d1kqsk_:

Click to download the PDB-style file with coordinates for d1kqsk_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsk_: