Lineage for d1kqsi_ (1kqs I:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120190Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
  4. 120191Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 120192Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 120193Protein Ribosomal protein L13 [52163] (1 species)
  7. 120194Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (3 PDB entries)
  8. 120196Domain d1kqsi_: 1kqs I: [68824]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsi_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsi_ c.21.1.1 (I:) Ribosomal protein L13 {Archaeon Haloarcula marismortui}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1kqsi_:

Click to download the PDB-style file with coordinates for d1kqsi_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsi_: