Lineage for d1kqsg_ (1kqs G:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529602Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 529603Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 529604Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 529605Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 529606Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (18 PDB entries)
  8. 529618Domain d1kqsg_: 1kqs G: [68822]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsg_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (G:)

SCOP Domain Sequences for d1kqsg_:

Sequence, based on SEQRES records: (download)

>d1kqsg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1kqsg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1kqsg_:

Click to download the PDB-style file with coordinates for d1kqsg_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsg_: