SCOP 1.59: Domain d1kqsg_: 1kqs G:

Lineage for d1kqsg_ (1kqs G:)

1. Root: SCOP 1.59

2. Class j: Peptides [58231] (92 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (2 PDB entries)

8. Domain d1kqsg_: 1kqs G: [68822]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsg_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsg_:

Sequence, based on SEQRES records:

>d1kqsg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1kqsg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1kqsg_:

• d1kqsg_ is new in SCOP 1.59
  
• d1kqsg_ appears in SCOP 1.61
  
• d1kqsg_ appears in the current release, SCOPe 2.08