SCOP 1.65: Domain d1kqsf_: 1kqs F:

Lineage for d1kqsf_ (1kqs F:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (12 PDB entries)

8. Domain d1kqsf_: 1kqs F: [68821]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
   complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsf_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsf_:

Sequence; same for both SEQRES and ATOM records:

>d1kqsf_ d.79.3.1 (F:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

Timeline for d1kqsf_:

• d1kqsf_ first appeared in SCOP 1.59
  
• d1kqsf_ appears in SCOP 1.63
  
• d1kqsf_ appears in SCOP 1.67
  
• d1kqsf_ appears in the current release, SCOPe 2.08