Lineage for d1kqsf_ (1kqs F:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134814Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 134894Superfamily d.79.3: L30e-like [55315] (2 families) (S)
  5. 134895Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 134905Protein Ribosomal protein L7ae [55319] (1 species)
  7. 134906Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (3 PDB entries)
  8. 134908Domain d1kqsf_: 1kqs F: [68821]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsf_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsf_ d.79.3.1 (F:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1kqsf_:

Click to download the PDB-style file with coordinates for d1kqsf_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsf_: