Lineage for d1kqse1 (1kqs E:1-79)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334675Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 334676Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 334677Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 334678Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 334679Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (12 PDB entries)
  8. 334684Domain d1kqse1: 1kqs E:1-79 [68819]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqse1

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqse1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqse1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1kqse1:

Click to download the PDB-style file with coordinates for d1kqse1.
(The format of our PDB-style files is described here.)

Timeline for d1kqse1: