Lineage for d1kqsd_ (1kqs D:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330692Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 330693Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 330694Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 330695Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 330696Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (12 PDB entries)
  8. 330699Domain d1kqsd_: 1kqs D: [68818]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsd_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsd_:

Sequence, based on SEQRES records: (download)

>d1kqsd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1kqsd_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1kqsd_:

Click to download the PDB-style file with coordinates for d1kqsd_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsd_: