Lineage for d1kqsa1 (1kqs A:91-237)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372810Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 372866Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 372867Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 372868Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (18 PDB entries)
  8. 372880Domain d1kqsa1: 1kqs A:91-237 [68814]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsa1

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsa1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1kqsa1:

Click to download the PDB-style file with coordinates for d1kqsa1.
(The format of our PDB-style files is described here.)

Timeline for d1kqsa1: