Lineage for d1kqs1_ (1kqs 1:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544787Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 544788Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 544789Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 544790Protein Ribosomal protein L39e [48664] (1 species)
  7. 544791Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)
  8. 544804Domain d1kqs1_: 1kqs 1: [68812]
    Other proteins in same PDB: d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqs1_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqs1_:

Sequence, based on SEQRES records: (download)

>d1kqs1_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1kqs1_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1kqs1_:

Click to download the PDB-style file with coordinates for d1kqs1_.
(The format of our PDB-style files is described here.)

Timeline for d1kqs1_: