SCOP 1.63: Domain d1kqs1_: 1kqs 1:

Lineage for d1kqs1_ (1kqs 1:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (8 PDB entries)

8. Domain d1kqs1_: 1kqs 1: [68812]
   Other proteins in same PDB: d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
   complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqs1_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqs1_:

Sequence, based on SEQRES records:

>d1kqs1_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1kqs1_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

Timeline for d1kqs1_:

• d1kqs1_ first appeared in SCOP 1.59
  
• d1kqs1_ appears in SCOP 1.61
  
• d1kqs1_ appears in SCOP 1.65
  
• d1kqs1_ appears in the current release, SCOPe 2.08