Lineage for d1kqcb_ (1kqc B:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.90: NADH oxidase/flavin reductase [55468] (1 superfamily) Superfamily d.90.1: NADH oxidase/flavin reductase [55469] (1 family) 
Family d.90.1.1: NADH oxidase/flavin reductase [55470] (3 proteins) 
Protein Nitroreductase [55476] (3 species) 
Species Enterobacter cloacae [TaxId:550] [55477] (4 PDB entries) 
Domain d1kqcb_: 1kqc B: [68803]
Details for d1kqcb_
PDB Entry: 1kqc (more details), 1.8 Å
PDB Description: structure of nitroreductase from e. cloacae complex with inhibitor acetate
SCOP Domain Sequences for d1kqcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqcb_ d.90.1.1 (B:) Nitroreductase {Enterobacter cloacae}
diisvalkrhstkafdaskkltaeeaekiktllqyspsstnsqpwhfivasteegkarva
ksaagtyvfnerkmldashvvvfcaktamddawlervvdqeeadgrfntpeakaanhkgr
tyfadmhrvdlkdddqwmakqvylnvgnfllgvgamgldavpiegfdaaildeefglkek
gftslvvvpvghhsvedfnatlpksrlplstivtec
SCOP Domain Coordinates for d1kqcb_:
Click to download the PDB-style file with coordinates for d1kqcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kqcb_:
- d1kqcb_ is new in SCOP 1.59
- d1kqcb_ appears in SCOP 1.61
- d1kqcb_ appears in the current release, SCOPe 2.08
View in 3D
