Lineage for d1kq8a_ (1kq8 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762145Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins)
  6. 762167Protein HFH-1 (HNF-3 forkhead homolog-1) [46839] (1 species)
  7. 762168Species Rat (Rattus norvegicus) [TaxId:10116] [46840] (1 PDB entry)
  8. 762169Domain d1kq8a_: 1kq8 A: [68797]

Details for d1kq8a_

PDB Entry: 1kq8 (more details)

PDB Description: solution structure of winged helix protein hfh-1
PDB Compounds: (A:) hepatocyte nuclear factor 3 forkhead homolog 1

SCOP Domain Sequences for d1kq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]}
yialitmairdsaggrltlaeineylmgkfpffrgsytgwrnsvrhnlslndcfvkvlrd
psrpwgkdnywmlnp

SCOP Domain Coordinates for d1kq8a_:

Click to download the PDB-style file with coordinates for d1kq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1kq8a_: