Lineage for d1kq8a_ (1kq8 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351781Family a.4.5.14: Forkhead DNA-binding domain [46832] (5 proteins)
  6. 351792Protein HFH-1 (HNF-3 forkhead homolog-1) [46839] (1 species)
  7. 351793Species Rat (Rattus norvegicus) [TaxId:10116] [46840] (1 PDB entry)
  8. 351794Domain d1kq8a_: 1kq8 A: [68797]

Details for d1kq8a_

PDB Entry: 1kq8 (more details)

PDB Description: solution structure of winged helix protein hfh-1

SCOP Domain Sequences for d1kq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus)}
yialitmairdsaggrltlaeineylmgkfpffrgsytgwrnsvrhnlslndcfvkvlrd
psrpwgkdnywmlnp

SCOP Domain Coordinates for d1kq8a_:

Click to download the PDB-style file with coordinates for d1kq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1kq8a_: