Lineage for d1kq5a_ (1kq5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069410Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families) (S)
    superhelix turns are made of two strands each
    automatically mapped to Pfam PF08603
  5. 2069411Family b.80.5.1: C-terminal domain of adenylylcyclase associated protein [69341] (1 protein)
  6. 2069412Protein C-terminal domain of adenylylcyclase associated protein [69342] (2 species)
  7. 2069413Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69343] (2 PDB entries)
  8. 2069416Domain d1kq5a_: 1kq5 A: [68795]

Details for d1kq5a_

PDB Entry: 1kq5 (more details), 3 Å

PDB Description: C-terminal Domain of Cyclase Associated Protein with PRO 505 Replaced by SER (P505S)
PDB Compounds: (A:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1kq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq5a_ b.80.5.1 (A:) C-terminal domain of adenylylcyclase associated protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mpprkelvgnkwfienyeneteslvidankdesifigkcsqvlvqikgkvnaislsetes
csvvldssisgmdviksnkfgiqvnhslpqisidksdggniylskeslnteiytscstai
nvnlpigedddyvefpiseqmkhsfadgkfksavfe

SCOPe Domain Coordinates for d1kq5a_:

Click to download the PDB-style file with coordinates for d1kq5a_.
(The format of our PDB-style files is described here.)

Timeline for d1kq5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kq5b_