SCOPe 2.04: Domain d1kpsd_: 1kps D:

Lineage for d1kpsd_ (1kps D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)
   automatically mapped to Pfam PF07834

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69102] (1 PDB entry)

8. Domain d1kpsd_: 1kps D: [68789]
   Other proteins in same PDB: d1kpsa_, d1kpsc_
   complexed with so4

Details for d1kpsd_

PDB Entry: 1kps, 2.5 Å

PDB Description: structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1

PDB Compounds: (D:) Ran-GTPase activating protein 1

SCOPe Domain Sequences for d1kpsd_:

Sequence; same for both SEQRES and ATOM records:

>d1kpsd_ a.118.12.1 (D:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
dlstflsfpspekllrlgpkvsvlivqqtdtsdpekvvsaflkvasvfrddasvktavld
aidalmkkafscssfnsntfltrllihmgllksedkikaipslhgplmvlnhvvrqdyfp
kalaplllafvtkpngaletcsfarhnllqtlyni

Timeline for d1kpsd_:

• d1kpsd_ first appeared in SCOP 1.59
  
• d1kpsd_ appears in SCOPe 2.03
  
• d1kpsd_ appears in SCOPe 2.05
  
• d1kpsd_ appears in the current release, SCOPe 2.08