| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) ![]() |
| Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
| Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [69102] (5 PDB entries) |
| Domain d1kpsb_: 1kps B: [68787] Other proteins in same PDB: d1kpsa_, d1kpsc_ complexed with so4 |
PDB Entry: 1kps (more details), 2.5 Å
SCOPe Domain Sequences for d1kpsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpsb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
tdlstflsfpspekllrlgpkvsvlivqqtdtsdpekvvsaflkvasvfrddasvktavl
daidalmkkafscssfnsntfltrllihmgllksedkikaipslhgplmvlnhvvrqdyf
pkalaplllafvtkpngaletcsfarhnllqtlyni
Timeline for d1kpsb_: