Lineage for d1kpsb_ (1kps B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100844Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
  5. 100845Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (1 protein)
  6. 100846Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (1 species)
  7. 100847Species Mouse (Mus musculus) [TaxId:10090] [69102] (1 PDB entry)
  8. 100848Domain d1kpsb_: 1kps B: [68787]
    Other proteins in same PDB: d1kpsa_, d1kpsc_

Details for d1kpsb_

PDB Entry: 1kps (more details), 2.5 Å

PDB Description: structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1

SCOP Domain Sequences for d1kpsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpsb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus)}
tdlstflsfpspekllrlgpkvsvlivqqtdtsdpekvvsaflkvasvfrddasvktavl
daidalmkkafscssfnsntfltrllihmgllksedkikaipslhgplmvlnhvvrqdyf
pkalaplllafvtkpngaletcsfarhnllqtlyni

SCOP Domain Coordinates for d1kpsb_:

Click to download the PDB-style file with coordinates for d1kpsb_.
(The format of our PDB-style files is described here.)

Timeline for d1kpsb_: