Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (20 PDB entries) identical sequence in many other species |
Domain d1kpsa_: 1kps A: [68786] Other proteins in same PDB: d1kpsb_, d1kpsd_ complexed with so4 |
PDB Entry: 1kps (more details), 2.5 Å
SCOPe Domain Sequences for d1kpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpsa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} smsgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfk lrmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqel lnepniqdpaqaeaytiycqnrveyekrvraqakkfaps
Timeline for d1kpsa_: