SCOPe 2.03: Domain d1kpla_: 1kpl A:

Lineage for d1kpla_ (1kpl A:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
   core: 18 transmembrane helices

4. Superfamily f.20.1: Clc chloride channel [81340] (1 family)

5. Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
   duplication: consist of two similar structural parts

6. Protein Clc chloride channel [69913] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [69915] (1 PDB entry)

8. Domain d1kpla_: 1kpl A: [68782]
   complexed with cl, mys, oct, so4

Details for d1kpla_

PDB Entry: 1kpl, 3 Å

PDB Description: crystal structure of the clc chloride channel from s. typhimurium

PDB Compounds: (A:) putative ClC family, chlorine transport protein

SCOPe Domain Sequences for d1kpla_:

Sequence; same for both SEQRES and ATOM records:

>d1kpla_ f.20.1.1 (A:) Clc chloride channel {Salmonella typhimurium [TaxId: 90371]}
tplailfmaavvgtltglvgvafekavswvqnmrigalvqvadhafllwplafilsalla
mvgyflvrkfapeaggsgipeiegaleelrpvrwwrvlpvkfiggmgtlgagmvlgregp
tvqiggnlgrmvldvfrmrsaearhtllatgaaaglsaafnaplagilfiieemrpqfry
nlisikavftgvimssivfrifngeapiievgklsdapvntlwlylilgiifgvvgpvfn
slvlrtqdmfqrfhggeikkwvlmggaigglcgilgliepaaagggfnlipiaaagnfsv
glllfifitrvvttllcfssgapggifapmlalgtllgtafgmaaavlfpqyhleagtfa
iagmgalmaasvrapltgivlvlemtdnyqlilpmiitclgatllaqflggkplystila
rtlakqdaeq

Timeline for d1kpla_:

• d1kpla_ first appeared in SCOP 1.59
  
• d1kpla_ appears in SCOPe 2.02
  
• d1kpla_ appears in SCOPe 2.04
  
• d1kpla_ appears in the current release, SCOPe 2.08