Lineage for d1kota1 (1kot A:3-119)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932721Protein GABA(A) receptor associated protein GABARAP [69658] (3 species)
  7. 2932722Species Human (Homo sapiens) [TaxId:9606] [69659] (9 PDB entries)
  8. 2932733Domain d1kota1: 1kot A:3-119 [68732]
    Other proteins in same PDB: d1kota2

Details for d1kota1

PDB Entry: 1kot (more details)

PDB Description: solution structure of human gaba receptor associated protein gabarap
PDB Compounds: (A:) gabarap

SCOPe Domain Sequences for d1kota1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kota1 d.15.1.3 (A:3-119) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

SCOPe Domain Coordinates for d1kota1:

Click to download the PDB-style file with coordinates for d1kota1.
(The format of our PDB-style files is described here.)

Timeline for d1kota1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kota2