Lineage for d1kohc2 (1koh C:104-200)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1028410Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 1028411Protein mRNA export factor tap [54955] (1 species)
  7. 1028412Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 1028414Domain d1kohc2: 1koh C:104-200 [68723]
    Other proteins in same PDB: d1koha1, d1kohb_, d1kohc1, d1kohd_
    mutant

Details for d1kohc2

PDB Entry: 1koh (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor
PDB Compounds: (C:) tip associating protein

SCOPe Domain Sequences for d1kohc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kohc2 d.58.7.2 (C:104-200) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
erggagtsqdgtsknwfkitipygrkydkawllsmiqskssvpftpiefhyentraqffv
edastasalkavnykildrenrrisiiinssapphti

SCOPe Domain Coordinates for d1kohc2:

Click to download the PDB-style file with coordinates for d1kohc2.
(The format of our PDB-style files is described here.)

Timeline for d1kohc2: