SCOPe 2.01: Domain d1kohc2: 1koh C:104-200

Lineage for d1kohc2 (1koh C:104-200)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)

6. Protein mRNA export factor tap [54955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)

8. Domain d1kohc2: 1koh C:104-200 [68723]
   Other proteins in same PDB: d1koha1, d1kohb_, d1kohc1, d1kohd_
   mutant

Details for d1kohc2

PDB Entry: 1koh, 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor

PDB Compounds: (C:) tip associating protein

SCOPe Domain Sequences for d1kohc2:

Sequence; same for both SEQRES and ATOM records:

>d1kohc2 d.58.7.2 (C:104-200) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
erggagtsqdgtsknwfkitipygrkydkawllsmiqskssvpftpiefhyentraqffv
edastasalkavnykildrenrrisiiinssapphti

Timeline for d1kohc2:

• d1kohc2 first appeared in SCOP 1.59
  
• d1kohc2 appears in SCOP 1.75
  
• d1kohc2 appears in SCOPe 2.02
  
• d1kohc2 appears in the current release, SCOPe 2.08