Lineage for d1kohb_ (1koh B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980294Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 980347Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 980379Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
    this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain
  6. 980380Protein mRNA export factor tap [52066] (1 species)
  7. 980381Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)
  8. 980383Domain d1kohb_: 1koh B: [68721]
    Other proteins in same PDB: d1koha2, d1kohc2
    mutant

Details for d1kohb_

PDB Entry: 1koh (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor
PDB Compounds: (B:) tip associating protein

SCOPe Domain Sequences for d1kohb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kohb_ c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii
eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel
wldgnslsdtfrdqstyisairerfpkllrldghelpppiafdveap

SCOPe Domain Coordinates for d1kohb_:

Click to download the PDB-style file with coordinates for d1kohb_.
(The format of our PDB-style files is described here.)

Timeline for d1kohb_: