Lineage for d1koha2 (1koh A:105-200)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908960Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 1908961Protein mRNA export factor tap [54955] (1 species)
  7. 1908962Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 1908963Domain d1koha2: 1koh A:105-200 [68720]
    Other proteins in same PDB: d1koha1, d1kohb_, d1kohc1, d1kohd_
    mutant

Details for d1koha2

PDB Entry: 1koh (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor
PDB Compounds: (A:) tip associating protein

SCOPe Domain Sequences for d1koha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koha2 d.58.7.2 (A:105-200) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
rggagtsqdgtsknwfkitipygrkydkawllsmiqskssvpftpiefhyentraqffve
dastasalkavnykildrenrrisiiinssapphti

SCOPe Domain Coordinates for d1koha2:

Click to download the PDB-style file with coordinates for d1koha2.
(The format of our PDB-style files is described here.)

Timeline for d1koha2: