Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein) |
Protein mRNA export factor tap [54955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries) |
Domain d1koha2: 1koh A:105-200 [68720] Other proteins in same PDB: d1koha1, d1kohb_, d1kohc1, d1kohd_ mutant |
PDB Entry: 1koh (more details), 3.8 Å
SCOPe Domain Sequences for d1koha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1koha2 d.58.7.2 (A:105-200) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} rggagtsqdgtsknwfkitipygrkydkawllsmiqskssvpftpiefhyentraqffve dastasalkavnykildrenrrisiiinssapphti
Timeline for d1koha2:
View in 3D Domains from other chains: (mouse over for more information) d1kohb_, d1kohc1, d1kohc2, d1kohd_ |