SCOPe 2.05: Domain d1koha1: 1koh A:201-362

Lineage for d1koha1 (1koh A:201-362)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.3: mRNA export factor tap [52065] (2 proteins)
   this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain

6. Protein mRNA export factor tap [52066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)

8. Domain d1koha1: 1koh A:201-362 [68719]
   Other proteins in same PDB: d1koha2, d1kohc2
   mutant

Details for d1koha1

PDB Entry: 1koh, 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor

PDB Compounds: (A:) tip associating protein

SCOPe Domain Sequences for d1koha1:

Sequence; same for both SEQRES and ATOM records:

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii
eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel
wldgnslsdtfrdqstyisairerfpkllrldghelpppiaf

Timeline for d1koha1:

• d1koha1 first appeared in SCOP 1.59
  
• d1koha1 appears in SCOPe 2.04
  
• d1koha1 appears in SCOPe 2.06
  
• d1koha1 appears in the current release, SCOPe 2.08