| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (8 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.3: mRNA export factor tap [52065] (1 protein) this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain |
| Protein mRNA export factor tap [52066] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries) |
| Domain d1koha1: 1koh A:201-362 [68719] Other proteins in same PDB: d1koha2, d1kohc2 |
PDB Entry: 1koh (more details), 3.8 Å
SCOP Domain Sequences for d1koha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii
eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel
wldgnslsdtfrdqstyisairerfpkllrldghelpppiaf
Timeline for d1koha1:
View in 3DDomains from other chains: (mouse over for more information) d1kohb_, d1kohc1, d1kohc2, d1kohd_ |