Class a: All alpha proteins [46456] (289 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) |
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
Protein 8-oxoguanine glycosylase [48160] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries) |
Domain d1ko9a1: 1ko9 A:136-323 [68717] Other proteins in same PDB: d1ko9a2 complexed with so4 |
PDB Entry: 1ko9 (more details), 2.15 Å
SCOPe Domain Sequences for d1ko9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ko9a1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq avlfsadl
Timeline for d1ko9a1: