Lineage for d1knzm_ (1knz M:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141665Fold e.34: NSP3 homodimer [69902] (1 superfamily)
  4. 141666Superfamily e.34.1: NSP3 homodimer [69903] (1 family) (S)
  5. 141667Family e.34.1.1: NSP3 homodimer [69904] (1 protein)
  6. 141668Protein NSP3 homodimer [69905] (1 species)
  7. 141669Species Simian 11 rotavirus [TaxId:10923] [69906] (1 PDB entry)
  8. 141676Domain d1knzm_: 1knz M: [68715]

Details for d1knzm_

PDB Entry: 1knz (more details), 2.45 Å

PDB Description: Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer
PDB Compounds: (M:)

SCOP Domain Sequences for d1knzm_:

Sequence, based on SEQRES records: (download)

>d1knzm_ e.34.1.1 (M:) NSP3 homodimer {Simian 11 rotavirus}
tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvlnacfsv
kripgksssiikctklmrdklergevevddsfvdekm

Sequence, based on observed residues (ATOM records): (download)

>d1knzm_ e.34.1.1 (M:) NSP3 homodimer {Simian 11 rotavirus}
tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlgidqkmrvlnacfsvkri
pgksssiikctklmrdklergevevddsfvdekm

SCOP Domain Coordinates for d1knzm_:

Click to download the PDB-style file with coordinates for d1knzm_.
(The format of our PDB-style files is described here.)

Timeline for d1knzm_: