Lineage for d1knzd1 (1knz D:4-153)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250086Fold e.34: NSP3 homodimer [69902] (1 superfamily)
    2 domains: (1) all-alpha, (2) alpha+beta; asymmetric homodimer with each domain intertwining with its counterpart
  4. 2250087Superfamily e.34.1: NSP3 homodimer [69903] (1 family) (S)
    automatically mapped to Pfam PF01665
  5. 2250088Family e.34.1.1: NSP3 homodimer [69904] (1 protein)
  6. 2250089Protein NSP3 homodimer [69905] (1 species)
    non-structural RNA-binding protein
  7. 2250090Species Simian 11 rotavirus [TaxId:10923] [69906] (1 PDB entry)
  8. 2250094Domain d1knzd1: 1knz D:4-153 [68712]
    Other proteins in same PDB: d1knzb2, d1knzd2, d1knzj2, d1knzn2
    protein/RNA complex

Details for d1knzd1

PDB Entry: 1knz (more details), 2.45 Å

PDB Description: Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer
PDB Compounds: (D:) Nonstructural RNA-binding Protein 34

SCOPe Domain Sequences for d1knzd1:

Sequence, based on SEQRES records: (download)

>d1knzd1 e.34.1.1 (D:4-153) NSP3 homodimer {Simian 11 rotavirus [TaxId: 10923]}
mestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnp
igkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvlnac
fsvkripgksssiikctklmrdklergeve

Sequence, based on observed residues (ATOM records): (download)

>d1knzd1 e.34.1.1 (D:4-153) NSP3 homodimer {Simian 11 rotavirus [TaxId: 10923]}
mestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnp
igkaitidqalndtsrpakldedvnklrmmlsskgidqkmrvlnacfsvkripgksssii
kctklmrdklergeve

SCOPe Domain Coordinates for d1knzd1:

Click to download the PDB-style file with coordinates for d1knzd1.
(The format of our PDB-style files is described here.)

Timeline for d1knzd1: