Lineage for d1knzd_ (1knz D:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954533Fold e.34: NSP3 homodimer [69902] (1 superfamily)
    2 domains: (1) all-alpha, (2) alpha+beta; asymmetric homodimer with each domain intertwining with its counterpart
  4. 1954534Superfamily e.34.1: NSP3 homodimer [69903] (1 family) (S)
    automatically mapped to Pfam PF01665
  5. 1954535Family e.34.1.1: NSP3 homodimer [69904] (1 protein)
  6. 1954536Protein NSP3 homodimer [69905] (1 species)
    non-structural RNA-binding protein
  7. 1954537Species Simian 11 rotavirus [TaxId:10923] [69906] (1 PDB entry)
  8. 1954541Domain d1knzd_: 1knz D: [68712]
    protein/RNA complex

Details for d1knzd_

PDB Entry: 1knz (more details), 2.45 Å

PDB Description: recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
PDB Compounds: (D:) Nonstructural RNA-binding Protein 34

SCOPe Domain Sequences for d1knzd_:

Sequence, based on SEQRES records: (download)

>d1knzd_ e.34.1.1 (D:) NSP3 homodimer {Simian 11 rotavirus [TaxId: 10923]}
gsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvkn
npigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvln
acfsvkripgksssiikctklmrdklergeve

Sequence, based on observed residues (ATOM records): (download)

>d1knzd_ e.34.1.1 (D:) NSP3 homodimer {Simian 11 rotavirus [TaxId: 10923]}
gsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvkn
npigkaitidqalndtsrpakldedvnklrmmlsskgidqkmrvlnacfsvkripgksss
iikctklmrdklergeve

SCOPe Domain Coordinates for d1knzd_:

Click to download the PDB-style file with coordinates for d1knzd_.
(The format of our PDB-style files is described here.)

Timeline for d1knzd_: