Lineage for d1knzc_ (1knz C:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250086Fold e.34: NSP3 homodimer [69902] (1 superfamily)
    2 domains: (1) all-alpha, (2) alpha+beta; asymmetric homodimer with each domain intertwining with its counterpart
  4. 2250087Superfamily e.34.1: NSP3 homodimer [69903] (1 family) (S)
    automatically mapped to Pfam PF01665
  5. 2250088Family e.34.1.1: NSP3 homodimer [69904] (1 protein)
  6. 2250089Protein NSP3 homodimer [69905] (1 species)
    non-structural RNA-binding protein
  7. 2250090Species Simian 11 rotavirus [TaxId:10923] [69906] (1 PDB entry)
  8. 2250093Domain d1knzc_: 1knz C: [68711]
    Other proteins in same PDB: d1knzb2, d1knzd2, d1knzj2, d1knzn2
    protein/RNA complex

Details for d1knzc_

PDB Entry: 1knz (more details), 2.45 Å

PDB Description: recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
PDB Compounds: (C:) Nonstructural RNA-binding Protein 34

SCOPe Domain Sequences for d1knzc_:

Sequence, based on SEQRES records: (download)

>d1knzc_ e.34.1.1 (C:) NSP3 homodimer {Simian 11 rotavirus [TaxId: 10923]}
tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvlnacfsv
kripgksssiikctklmrdklergevevddsfvdekm

Sequence, based on observed residues (ATOM records): (download)

>d1knzc_ e.34.1.1 (C:) NSP3 homodimer {Simian 11 rotavirus [TaxId: 10923]}
tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlgidqkmrvlnacfsvkri
pgksssiikctklmrdklergevevddsfvdekm

SCOPe Domain Coordinates for d1knzc_:

Click to download the PDB-style file with coordinates for d1knzc_.
(The format of our PDB-style files is described here.)

Timeline for d1knzc_: