Lineage for d1knvb_ (1knv B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 585998Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins)
  6. 585999Protein Restriction endonuclease Bse634I [69523] (1 species)
  7. 586000Species Bacillus stearothermophilus [TaxId:1422] [69524] (1 PDB entry)
  8. 586002Domain d1knvb_: 1knv B: [68708]
    complexed with act, cl

Details for d1knvb_

PDB Entry: 1knv (more details), 2.17 Å

PDB Description: Bse634I restriction endonuclease

SCOP Domain Sequences for d1knvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knvb_ c.52.1.7 (B:) Restriction endonuclease Bse634I {Bacillus stearothermophilus}
tnltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakg
laiptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetre
klhqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdi
egkckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmrywnpkaefkyygasse
pvskadddalqtaathtivnvnstperavddifsltsfedidkmldqiikk

SCOP Domain Coordinates for d1knvb_:

Click to download the PDB-style file with coordinates for d1knvb_.
(The format of our PDB-style files is described here.)

Timeline for d1knvb_: