![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) ![]() |
![]() | Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins) |
![]() | Protein Restriction endonuclease Bse634I [69523] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [69524] (1 PDB entry) |
![]() | Domain d1knva_: 1knv A: [68707] |
PDB Entry: 1knv (more details), 2.17 Å
SCOP Domain Sequences for d1knva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knva_ c.52.1.7 (A:) Restriction endonuclease Bse634I {Bacillus stearothermophilus} nltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakgl aiptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetrek lhqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdie gkckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmrywnpkaefkyygassep vskadddalqtaathtivnvnstperavddifsltsfedidkmldqiikk
Timeline for d1knva_: