Lineage for d1kmya2 (1kmy A:133-289)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645158Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1645159Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1645312Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1645313Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 1645314Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [54605] (6 PDB entries)
  8. 1645326Domain d1kmya2: 1kmy A:133-289 [68698]
    complexed with bpy, fe2, tbu

Details for d1kmya2

PDB Entry: 1kmy (more details), 2 Å

PDB Description: Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with 2,3-dihydroxybiphenyl under Anaerobic Condition
PDB Compounds: (A:) 2,3-dihydroxybiphenyl 1,2-dioxygenase

SCOPe Domain Sequences for d1kmya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmya2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne
rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas
tpsgveveygwsartvdrswvvvrhdspsmwghksvr

SCOPe Domain Coordinates for d1kmya2:

Click to download the PDB-style file with coordinates for d1kmya2.
(The format of our PDB-style files is described here.)

Timeline for d1kmya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kmya1