Lineage for d1kmya1 (1kmy A:2-132)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255972Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 255973Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 256037Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 256038Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 256039Species Burkholderia cepacia (formerly Pseudomonas cepacia) [54605] (6 PDB entries)
  8. 256046Domain d1kmya1: 1kmy A:2-132 [68697]

Details for d1kmya1

PDB Entry: 1kmy (more details), 2 Å

PDB Description: Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with 2,3-dihydroxybiphenyl under Anaerobic Condition

SCOP Domain Sequences for d1kmya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmya1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia (formerly Pseudomonas cepacia)}
sirslgymgfavsdvaawrsfltqklglmeagttdngdlfridsrawriavqqgevddla
fagyevadaaglaqmadklkqagiavttgdaslarrrgvtglitfadpfglpleiyygas
evfekpflpga

SCOP Domain Coordinates for d1kmya1:

Click to download the PDB-style file with coordinates for d1kmya1.
(The format of our PDB-style files is described here.)

Timeline for d1kmya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kmya2