Lineage for d1kmka_ (1kmk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866508Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1866677Protein NifS-like protein/selenocysteine lyase [53412] (2 species)
  7. 1866678Species Escherichia coli [TaxId:562] [53414] (5 PDB entries)
    gene product CsdB
  8. 1866681Domain d1kmka_: 1kmk A: [68696]
    complexed with plp, sec

Details for d1kmka_

PDB Entry: 1kmk (more details), 2.2 Å

PDB Description: e. coli nifs/csdb protein at 2.20a with the cysteine perselenide intermediate (residue csz).
PDB Compounds: (A:) selenocysteine lyase

SCOPe Domain Sequences for d1kmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmka_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]}
ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOPe Domain Coordinates for d1kmka_:

Click to download the PDB-style file with coordinates for d1kmka_.
(The format of our PDB-style files is described here.)

Timeline for d1kmka_: