SCOP 1.67: Domain d1kkob2: 1kko B:1-160

Lineage for d1kkob2 (1kko B:1-160)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein beta-Methylaspartase [69714] (2 species)

7. Species Citrobacter amalonaticus [TaxId:35703] [69716] (2 PDB entries)

8. Domain d1kkob2: 1kko B:1-160 [68678]
   Other proteins in same PDB: d1kkoa1, d1kkob1
   complexed with sul

Details for d1kkob2

PDB Entry: 1kko, 1.33 Å

PDB Description: crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase

SCOP Domain Sequences for d1kkob2:

Sequence; same for both SEQRES and ATOM records:

>d1kkob2 d.54.1.1 (B:1-160) beta-Methylaspartase {Citrobacter amalonaticus}
mkikqalftagyssfyfddqqaikngaghdgfiytgdpvtpgftsvrqagecvsvqlile
ngavavgdcaavqysgaggrdplflaehfipflndhikpllegrdvdaflpnarffdklr
idgnllhtavryglsqalldatalasgrlktevvcdewql

Timeline for d1kkob2:

• d1kkob2 first appeared in SCOP 1.59
  
• d1kkob2 appears in SCOP 1.65
  
• d1kkob2 appears in SCOP 1.69
  
• d1kkob2 appears in the current release, SCOPe 2.08