Lineage for d1kkob1 (1kko B:161-411)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 573010Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins)
  6. 573011Protein beta-Methylaspartase [69400] (2 species)
  7. 573012Species Citrobacter amalonaticus [TaxId:35703] [69402] (2 PDB entries)
  8. 573014Domain d1kkob1: 1kko B:161-411 [68677]
    Other proteins in same PDB: d1kkoa2, d1kkob2
    complexed with sul

Details for d1kkob1

PDB Entry: 1kko (more details), 1.33 Å

PDB Description: crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase

SCOP Domain Sequences for d1kkob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkob1 c.1.11.2 (B:161-411) beta-Methylaspartase {Citrobacter amalonaticus}
pcvpeaiplfgqsgddryiavdkmilkgvdvlphalinnveeklgfkgeklreyvrwlsd
rilslrsspryhptlhidvygtiglifdmdpvrcaeyiaslekeaqglplyiegpvdagn
kpdqirmltaitkeltrlgsgvkivadewcntyqdivdftdagschmvqiktpdlggihn
ivdavlycnkhgmeayqggtcneteisartcvhvalaarpmrmlikpgmgfdeglnivfn
emnrtiallqt

SCOP Domain Coordinates for d1kkob1:

Click to download the PDB-style file with coordinates for d1kkob1.
(The format of our PDB-style files is described here.)

Timeline for d1kkob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kkob2