Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins) |
Protein beta-Methylaspartase [69400] (2 species) |
Species Citrobacter amalonaticus [TaxId:35703] [69402] (2 PDB entries) |
Domain d1kkob1: 1kko B:161-411 [68677] Other proteins in same PDB: d1kkoa2, d1kkob2 complexed with sul |
PDB Entry: 1kko (more details), 1.33 Å
SCOP Domain Sequences for d1kkob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkob1 c.1.11.2 (B:161-411) beta-Methylaspartase {Citrobacter amalonaticus} pcvpeaiplfgqsgddryiavdkmilkgvdvlphalinnveeklgfkgeklreyvrwlsd rilslrsspryhptlhidvygtiglifdmdpvrcaeyiaslekeaqglplyiegpvdagn kpdqirmltaitkeltrlgsgvkivadewcntyqdivdftdagschmvqiktpdlggihn ivdavlycnkhgmeayqggtcneteisartcvhvalaarpmrmlikpgmgfdeglnivfn emnrtiallqt
Timeline for d1kkob1: