SCOPe 2.05: Domain d1kkeb2: 1kke B:313-455

Lineage for d1kkeb2 (1kke B:313-455)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins)

6. Protein Reovirus attachment protein sigma 1 head domain [69226] (1 species)

7. Species Reovirus [TaxId:10891] [69227] (1 PDB entry)

8. Domain d1kkeb2: 1kke B:313-455 [68672]
   Other proteins in same PDB: d1kkea1, d1kkeb1, d1kkec1

Details for d1kkeb2

PDB Entry: 1kke, 2.6 Å

PDB Description: Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer

PDB Compounds: (B:) sigma 1 protein

SCOPe Domain Sequences for d1kkeb2:

Sequence; same for both SEQRES and ATOM records:

>d1kkeb2 b.21.1.2 (B:313-455) Reovirus attachment protein sigma 1 head domain {Reovirus [TaxId: 10891]}
yrfrqsmwigivsysgsglnwrvqvnsdifivddyihiclpafdgfsiadggdlslnfvt
gllpplltgdtepafhndvvtygaqtvaiglssggapqymsknlwveqwqdgvlrlrveg
ggsithsnskwpamtvsyprsft

Timeline for d1kkeb2:

• d1kkeb2 first appeared in SCOP 1.59
  
• d1kkeb2 appears in SCOPe 2.04
  
• d1kkeb2 appears in SCOPe 2.06
  
• d1kkeb2 appears in the current release, SCOPe 2.08