Lineage for d1kkda_ (1kkd A:)
- Root: SCOP 1.59
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (11 families) 
Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins) Protein Small conductance potassium channel [64528] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [64529] (2 PDB entries) 
Domain d1kkda_: 1kkd A: [68668]
Details for d1kkda_
PDB Entry: 1kkd (more details)
PDB Description: solution structure of the calmodulin binding domain (cambd) of small conductance ca2+-activated potassium channels (sk2)
SCOP Domain Sequences for d1kkda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkda_ f.2.1.11 (A:) Small conductance potassium channel {Rat (Rattus norvegicus)}
rkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrk
flqaihqlrsvkmeqrklndqantlvdlaktq
SCOP Domain Coordinates for d1kkda_:
Click to download the PDB-style file with coordinates for d1kkda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kkda_:
- d1kkda_ is new in SCOP 1.59
- d1kkda_ appears in SCOP 1.61
- d1kkda_ appears in the current release, SCOPe 2.08
View in 3D