| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [54721] (6 species) |
| Species Aspergillus fumigatus [TaxId:5085] [69693] (1 PDB entry) |
| Domain d1kkcy2: 1kkc Y:98-213 [68667] Other proteins in same PDB: d1kkca1, d1kkcb1, d1kkcx1, d1kkcy1 |
PDB Entry: 1kkc (more details), 2 Å
SCOP Domain Sequences for d1kkcy2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkcy2 d.44.1.1 (Y:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus}
eksgggkidqapvlkaaieqrwgsfdkfkdafnttllgiqgsgwgwlvtdgpkgklditt
thdqdpvtgaapvfgvdmwehayylqylndkasyakgiwnvinwaeaenryiagdk
Timeline for d1kkcy2: